HPA007667

MAPK13 antibody from Atlas Antibodies
p38delta, PRKM13, SAPK4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007667
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007667, RRID:AB_888621
Product name
Anti-MAPK13
Provider product page
Atlas Antibodies - HPA007667
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKA
AKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKML
ELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPF
DDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -