HPA008180

antibody from Atlas Antibodies

Targeting: MST1R CD136, CDw136, PTK8, RON, SEA

Antibody data

Submit

Validation data

Product number: HPA008180 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008180, RRID:AB_1079291
Product name: Anti-MST1R
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLS FHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGW VAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVP LKP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MST1R protein structure - HPA008180 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and skin using Anti-MST1R antibody HPA008180 (A) shows similar protein distribution across tissues to independent antibody HPA007657 (B).
Antibody #2 product nr: HPA007657
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human vagina shows strong cytoplasmic positivity in squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-MST1R antibody HPA008180.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MST1R antibody HPA008180.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MST1R antibody HPA008180.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MST1R antibody HPA008180.
Sample type: HUMAN