HPA008180

MST1R antibody from Atlas Antibodies
CD136, CDw136, PTK8, RON, SEA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008180
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008180, RRID:AB_1079291
Product name
Anti-MST1R
Provider product page
Atlas Antibodies - HPA008180
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLS
FHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGW
VAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVP
LKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -