HPA008180

MST1R antibody from Sigma-Aldrich
CD136, CDw136, PTK8, RON
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008180
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008180, RRID:AB_1079291
Product name
Anti-MST1R antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008180
Antibody type
Polyclonal
Antigen
Macrophage-stimulating protein receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLS
FHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGW
VAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVP
LKP
Storage
-20C
Provider Type Product Number
- No reagents -