HPA010657

LMTK2 antibody from Sigma-Aldrich
AATYK2, BREK, cprk, KIAA1079, KPI-2, KPI2, LMR2, PPP1R100
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010657, RRID:AB_1079259
Product name
Anti-LMTK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010657
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase LMTK2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MELNGVQADFKPATLSSSLDNPKESVITGHFEKEK
PRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFL
FLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAML
ETSCRNSLDTELQFAENKPGLSLLQENV
Storage
-20C
Provider Type Product Number
- No reagents -