HPA010694

ALK antibody from Sigma-Aldrich
CD246
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010694
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010694, RRID:AB_1078133
Product name
Anti-ALK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010694
Antibody type
Polyclonal
Antigen
ALK tyrosine kinase receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSF
PFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSW
SWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLL
NTSADSKHTILS
Storage
-20C
Provider Type Product Number
- No reagents -