Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502754 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKN
KDMIQ TLTNKSKIQN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human glucocorticoid-induced TNF receptor ligand regulates its signaling activity through multiple oligomerization states.
Zhou Z, Song X, Berezov A, Zhang G, Li Y, Zhang H, Murali R, Li B, Greene MI
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 8;105(14):5465-70
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 8;105(14):5465-70
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting