HPA012699

TNFSF18 antibody from Sigma-Aldrich
AITRL, hGITRL, TL6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012699
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012699, RRID:AB_1849698
Product name
Anti-TNFSF18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012699
Antibody type
Polyclonal
Antigen
Tumor necrosis factor ligand superfamily member 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQ
NGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQT
LTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKN
NTYWGIILLANPQFIS
Storage
-20C
Provider Type Product Number
- No reagents -