HPA010022

ALDH1A2 antibody from Sigma-Aldrich
RALDH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010022
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010022, RRID:AB_1844723
Product name
Anti-ALDH1A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010022
Antibody type
Polyclonal
Antigen
Retinal dehydrogenase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEG
AKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEE
IFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTN
DINKALTVSSAMQAGTV
Storage
-20C
Provider Type Product Number
- No reagents -