Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001312-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001312-M01, RRID:AB_425377
- Product name
- COMT monoclonal antibody (M01), clone 1G4-1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant COMT.
- Antigen sequence
MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAV
RMARLLSPGARLITIEINPDCAAITQRMVDFAGMK
DKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWK
DRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDF
LAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKG
PGSEAGP- Isotype
- IgG
- Antibody clone number
- 1G4-1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- COMT monoclonal antibody (M01), clone 1G4-1A1 Western Blot analysis of COMT expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of COMT expression in transfected 293T cell line by COMT monoclonal antibody (M01), clone 1G4-1A1.Lane 1: COMT transfected lysate(24.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged COMT is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol