HPA001169

COMT antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001169
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001169, RRID:AB_1078402
Product name
Anti-COMT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001169
Antibody type
Polyclonal
Antigen
Catechol O-methyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELG
AYCGYSAVRMARLLSPGARLITIEINPDCAAITQR
MVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLD
MVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNV
ICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDG
LEKAIY
Storage
-20C
Provider Type Product Number
- No reagents -