Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20499 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20499, RRID:AB_10965778
- Product name
- NFKBIZ polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant NFKBIZ.
- Antigen sequence
QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAV
AANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEK
GHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHC
AVIAHNAVVHELQRNQQPHSPEVQELLL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Dynamics of the Transcriptome during Human Spermatogenesis: Predicting the Potential Key Genes Regulating Male Gametes Generation.
Zhu Z, Li C, Yang S, Tian R, Wang J, Yuan Q, Dong H, He Z, Wang S, Li Z
Scientific reports 2016 Jan 12;6:19069
Scientific reports 2016 Jan 12;6:19069
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human spleen with NFKBIZ polyclonal antibody (Cat # PAB20499) shows strong nuclear positivity in cells of red pulp at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)