Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182551 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sirtuin 2 (SIRT2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIRT2 antibody: synthetic peptide directed towards the N terminal of human SIRT2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGE
ADMDF LRNLFSQTLS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Effects of niacin restriction on sirtuin and PARP responses to photodamage in human skin.
Substrate specificity and kinetic mechanism of the Sir2 family of NAD+-dependent histone/protein deacetylases.
Benavente CA, Schnell SA, Jacobson EL
PloS one 2012;7(7):e42276
PloS one 2012;7(7):e42276
Substrate specificity and kinetic mechanism of the Sir2 family of NAD+-dependent histone/protein deacetylases.
Borra MT, Langer MR, Slama JT, Denu JM
Biochemistry 2004 Aug 3;43(30):9877-87
Biochemistry 2004 Aug 3;43(30):9877-87
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting