Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182552 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sirtuin 2 (SIRT2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIRT2 antibody: synthetic peptide directed towards the N terminal of human SIRT2
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGE
ADMDF LRNLFSQTLS- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The response of autologous T cells to a human melanoma is dominated by mutated neoantigens.
Lennerz V, Fatho M, Gentilini C, Frye RA, Lifke A, Ferel D, Wölfel C, Huber C, Wölfel T
Proceedings of the National Academy of Sciences of the United States of America 2005 Nov 1;102(44):16013-8
Proceedings of the National Academy of Sciences of the United States of America 2005 Nov 1;102(44):16013-8
No comments: Submit comment
No validations: Submit validation data