Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487120 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSEL
DTIDS QHRVHEDIEM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
Uhl GR, Liu QR, Drgon T, Johnson C, Walther D, Rose JE, David SP, Niaura R, Lerman C
Archives of general psychiatry 2008 Jun;65(6):683-93
Archives of general psychiatry 2008 Jun;65(6):683-93
No comments: Submit comment
No validations: Submit validation data