HPA009172

SLC1A2 antibody from Atlas Antibodies
EAAT2, GLT-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009172
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009172, RRID:AB_1849764
Product name
Anti-SLC1A2
Provider product page
Atlas Antibodies - HPA009172
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVA
PPPDEEANATSAVVSLLNETVTEVPEETKMVIKKG
LEFKDGMNV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -