HPA009172

SLC1A2 antibody from Atlas Antibodies
EAAT2, GLT-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009172
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009172, RRID:AB_1234464
Product name
Anti-SLC1A2
Provider product page
Atlas Antibodies - HPA009172
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVA
PPPDEEANATSAVVSLLNETVTEVPEETKMVIKKG
LEFKDGMNV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -