HPA009172

SLC1A2 antibody from Sigma-Aldrich
EAAT2, GLT-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009172
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009172, RRID:AB_1849764
Product name
Anti-SLC1A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009172
Antibody type
Polyclonal
Antigen
Excitatory amino acid transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVA
PPPDEEANATSAVVSLLNETVTEVPEETKMVIKKG
LEFKDGMNV
Storage
-20C
Provider Type Product Number
- No reagents -