Antibody data

Product number
H00001727-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001727-M01, RRID:AB_1137155
Product name
CYB5R3 monoclonal antibody (M01), clone 2A9
Provider product page
Abnova Corporation - H00001727-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CYB5R3.
Antigen sequence
FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVI
RAIMKDPDDHTVCHLLFANQTEKDILLRPELEELR
NKHSARFKLWYTLDRAPEAWDYGQGF
Isotype
IgG
Antibody clone number
2A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -