HPA001566

CYB5R3 antibody from Atlas Antibodies
DIA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001566
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001566, RRID:AB_1078601
Product name
Anti-CYB5R3
Provider product page
Atlas Antibodies - HPA001566
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKD
ILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQ
GFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACL
PNLDH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -