H00000775-M20

CACNA1C antibody from Abnova Corporation
CACH2, CACN2, CACNL1A1, Cav1.2, CCHL1A1, LQT8, TS

Antibody data

Product number
H00000775-M20
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000775-M20, RRID:AB_1571909
Product name
CACNA1C monoclonal antibody (M20), clone 4D10
Provider product page
Abnova Corporation - H00000775-M20
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CACNA1C.
Antigen sequence
AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEE
MESAADNILSGGAPQSPNGALLPFVNCRDAGQDRA
GGEEDAGCVRARGRPSEEELQDSRVYVSSL
Isotype
IgG
Antibody clone number
4D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -