Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310601 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Flavin Containing Monooxygenase 3 (FMO3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNK
HPDFA TTGQWDVTTE- Vial size
- 50 µg
Submitted references Expression and genomic status of EGFR and ErbB-2 in alveolar and embryonal rhabdomyosarcoma.
Quantitative analysis of FMO gene mRNA levels in human tissues.
Ganti R, Skapek SX, Zhang J, Fuller CE, Wu J, Billups CA, Breitfeld PP, Dalton JD, Meyer WH, Khoury JD
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2006 Sep;19(9):1213-20
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2006 Sep;19(9):1213-20
Quantitative analysis of FMO gene mRNA levels in human tissues.
Zhang J, Cashman JR
Drug metabolism and disposition: the biological fate of chemicals 2006 Jan;34(1):19-26
Drug metabolism and disposition: the biological fate of chemicals 2006 Jan;34(1):19-26
No comments: Submit comment
No validations: Submit validation data