HPA013750

FMO3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013750, RRID:AB_1848968
Product name
Anti-FMO3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013750
Antibody type
Polyclonal
Antigen
Dimethylaniline monooxygenase [N-oxide-forming] 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQ
EYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTG
QWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPK
Storage
-20C
Provider Type Product Number
- No reagents -