HPA014769

ALDH3A2 antibody from Atlas Antibodies
ALDH10, FALDH, SLS

Antibody data

Product number
HPA014769
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014769, RRID:AB_1844728
Product name
Anti-ALDH3A2
Provider product page
Atlas Antibodies - HPA014769
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPF
GGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREG
ANKLRYPPNSQSKVDWGKFFLLKRFNKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.