HPA037896

NSUN2 antibody from Atlas Antibodies
FLJ20303, Misu, MRT5, TRM4
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA037896
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037896, RRID:AB_10670532
Product name
Anti-NSUN2
Provider product page
Atlas Antibodies - HPA037896
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTT
EGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVW
CRNNSGEEFDCAFRLAQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -