PAB23182

NSUN2 antibody from Abnova Corporation
FLJ20303, Misu, MRT5, TRM4

Antibody data

Product number
PAB23182
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23182, RRID:AB_11123772
Product name
NSUN2 polyclonal antibody
Provider product page
Abnova Corporation - PAB23182
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant NSUN2.
Antigen sequence
PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTT
EGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVW
CRNNSGEEFDCAFRLAQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -