AV48811

NSUN2 antibody from Sigma-Aldrich
FLJ20303, Misu, MRT5, TRM4
No application information provided.

Antibody data

Product number
AV48811
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV48811, RRID:AB_1854656
Product name
Anti-NSUN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV48811
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human NSUN2 with an internal ID of P28861
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YPFINSRIITVSMEDVKILLTQENPFFRKLSSETY
SQAKDLAKGSIVLKY
Storage
-20C
Provider Type Product Number
- No reagents -