Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004552-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004552-M01, RRID:AB_489986
- Product name
- MTRR monoclonal antibody (M01), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MTRR.
- Antigen sequence
MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADL
HCISESDKYDLKTETAPLVVVVSTTGTGDPPDTAR
KFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFC
NGGKI- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Diflavin oxidoreductases activate the bioreductive prodrug PR-104A under hypoxia.
Guise CP, Abbattista MR, Tipparaju SR, Lambie NK, Su J, Li D, Wilson WR, Dachs GU, Patterson AV
Molecular pharmacology 2012 Jan;81(1):31-40
Molecular pharmacology 2012 Jan;81(1):31-40
No comments: Submit comment
No validations: Submit validation data