Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039526 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039526, RRID:AB_10673534
- Product name
- Anti-ATP12A
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELK
KKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMG
LSSTR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Airway surface hyperviscosity and defective mucociliary transport by IL-17/TNF-α are corrected by β-adrenergic stimulus
Proton Pump Inhibitors Reduce Pancreatic Adenocarcinoma Progression by Selectively Targeting H+, K+-ATPases in Pancreatic Cancer and Stellate Cells
Increased expression of ATP12A proton pump in cystic fibrosis airways
Goblet Cell Hyperplasia Requires High Bicarbonate Transport To Support Mucin Release
Proton Pump Inhibitors Inhibit Pancreatic Secretion: Role of Gastric and Non-Gastric H+/K+-ATPases
Guidone D, Buccirossi M, Scudieri P, Genovese M, Sarnataro S, De Cegli R, Cresta F, Terlizzi V, Planelles G, Crambert G, Sermet I, Galietta L
JCI Insight 2022;7(22)
JCI Insight 2022;7(22)
Proton Pump Inhibitors Reduce Pancreatic Adenocarcinoma Progression by Selectively Targeting H+, K+-ATPases in Pancreatic Cancer and Stellate Cells
Tozzi M, Sørensen C, Magni L, Christensen N, Bouazzi R, Buch C, Stefanini M, Duranti C, Arcangeli A, Novak I
Cancers 2020;12(3):640
Cancers 2020;12(3):640
Increased expression of ATP12A proton pump in cystic fibrosis airways
Scudieri P, Musante I, Caci E, Venturini A, Morelli P, Walter C, Tosi D, Palleschi A, Martin-Vasallo P, Sermet-Gaudelus I, Planelles G, Crambert G, Galietta L
JCI Insight 2018;3(20)
JCI Insight 2018;3(20)
Goblet Cell Hyperplasia Requires High Bicarbonate Transport To Support Mucin Release
Gorrieri G, Scudieri P, Caci E, Schiavon M, Tomati V, Sirci F, Napolitano F, Carrella D, Gianotti A, Musante I, Favia M, Casavola V, Guerra L, Rea F, Ravazzolo R, Di Bernardo D, Galietta L
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
Proton Pump Inhibitors Inhibit Pancreatic Secretion: Role of Gastric and Non-Gastric H+/K+-ATPases
Strnad P, Wang J, Barbuskaite D, Tozzi M, Giannuzzo A, Sørensen C, Novak I
PLOS ONE 2015;10(5):e0126432
PLOS ONE 2015;10(5):e0126432
No comments: Submit comment
No validations: Submit validation data