H00008398-B01P

PLA2G6 antibody from Abnova Corporation
iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9

Antibody data

Product number
H00008398-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008398-B01P, RRID:AB_1578867
Product name
PLA2G6 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008398-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PLA2G6 protein.
Antigen sequence
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSS
DRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR
LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTE
VLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI
ISCANCAENEEGCTPLHLACRKGDGEILVELVQYC
HTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV
AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNAR
CNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH
SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSS
AGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG
NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGET
PTFLASKIGRQLQDLMHISRARKPAFILGSMRDEK
RTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATK
DLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRM
KDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRK
PKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFN
QNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGR
FLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKV
KKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAK
TVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVG
IQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYI
YEHREEFQKLIQLLLSP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -