HPA001171

PLA2G6 antibody from Sigma-Aldrich
iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001171
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001171, RRID:AB_1079145
Product name
Anti-PLA2G6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001171
Antibody type
Polyclonal
Antigen
85 kDa calcium-independent phospholipase A2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIREC
FHHSRIISCANCAENEEGCTPLHLACRKGDGEILV
ELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQL
LGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVL
LLCNARCNIMG
Storage
-20C
Provider Type Product Number
- No reagents -