H00055835-M02
antibody from Abnova Corporation
Targeting: CENPJ
BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055835-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055835-M02, RRID:AB_1112549
- Product name
- CENPJ monoclonal antibody (M02), clone 1A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CENPJ.
- Antigen sequence
KYTTAARTFPDKKEREEIQTLKQQIADLREDLKRK
ETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERF
RLDAWKRAEAIESSLEVEKKDKLANTSVRFQNSQI
SSGTQ- Isotype
- IgG
- Antibody clone number
- 1A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CENPJ expression in transfected 293T cell line by CENPJ monoclonal antibody (M02), clone 1A5.Lane 1: CENPJ transfected lysate(43.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CENPJ is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CENPJ transfected lysate using anti-CENPJ monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CENPJ MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol