HPA001402

ERLIN1 antibody from Sigma-Aldrich
C10orf69, Erlin-1, KE04, SPFH1, SPG62
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001402
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001402, RRID:AB_1079125
Product name
Anti-CHUK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001402
Antibody type
Polyclonal
Antigen
SPFH domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVE
VALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQS
SARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSC
VVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQ
GNSMMN
Storage
-20C
Provider Type Product Number
- No reagents -