HPA011252

ERLIN1 antibody from Atlas Antibodies
C10orf69, Erlin-1, KE04, SPFH1, SPG62
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011252
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011252, RRID:AB_1853965
Product name
Anti-ERLIN1
Provider product page
Atlas Antibodies - HPA011252
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AREKAKADAEYYAAHKYATSNKHKLTPEYLELKKY
QAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGR
ESSLPSKEALEPSGENVIQNK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -