HPA011252

ERLIN1 antibody from Atlas Antibodies
C10orf69, Erlin-1, KE04, SPFH1, SPG62
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011252
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011252, RRID:AB_1235719
Product name
Anti-ERLIN1
Provider product page
Atlas Antibodies - HPA011252
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AREKAKADAEYYAAHKYATSNKHKLTPEYLELKKY
QAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGR
ESSLPSKEALEPSGENVIQNK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -