HPA011252

ERLIN1 antibody from Sigma-Aldrich
C10orf69, Erlin-1, KE04, SPFH1, SPG62
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011252, RRID:AB_1853965
Product name
Anti-ERLIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011252
Antibody type
Polyclonal
Antigen
Erlin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AREKAKADAEYYAAHKYATSNKHKLTPEYLELKKY
QAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGR
ESSLPSKEALEPSGENVIQNK
Storage
-20C
Provider Type Product Number
- No reagents -