Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502807 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sad1 and UNC84 Domain Containing 2 (SUN2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the N terminal of human UNC84B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLE
ALAAE FSSNWQKEAM- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
Cerhan JR, Ansell SM, Fredericksen ZS, Kay NE, Liebow M, Call TG, Dogan A, Cunningham JM, Wang AH, Liu-Mares W, Macon WR, Jelinek D, Witzig TE, Habermann TM, Slager SL
Blood 2007 Dec 15;110(13):4455-63
Blood 2007 Dec 15;110(13):4455-63
No comments: Submit comment
No validations: Submit validation data