HPA015490

CDH20 antibody from Sigma-Aldrich
Cdh7, CDH7L3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015490
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015490, RRID:AB_1845900
Product name
Anti-CDH20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015490
Antibody type
Polyclonal
Antigen
Cadherin-20 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVA
IGTTIQIISAKDPDVTNNSIRYSIDRSSDPGRFFY
VDITTGALMTARPLDREEFSWHNITVLAMEMNNPS
QVGSVPVTIKV
Storage
-20C
Provider Type Product Number
- No reagents -