HPA015490

CDH20 antibody from Atlas Antibodies
Cdh7, CDH7L3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015490
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015490, RRID:AB_1233658
Product name
Anti-CDH20
Provider product page
Atlas Antibodies - HPA015490
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVA
IGTTIQIISAKDPDVTNNSIRYSIDRSSDPGRFFY
VDITTGALMTARPLDREEFSWHNITVLAMEMNNPS
QVGSVPVTIKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -