Antibody data

Product number
H00002208-M14
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002208-M14, RRID:AB_1136932
Product name
FCER2 monoclonal antibody (M14), clone 2A7
Provider product page
Abnova Corporation - H00002208-M14
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FCER2.
Antigen sequence
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALW
AGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKN
LESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQ
DLELSWNLNGLQADLSSFKSQELNERNEASDLLER
LREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCY
YFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFL
TKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNW
APGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAW
VCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTP
SAPLHS
Isotype
IgG
Antibody clone number
2A7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -