HPA008928

FCER2 antibody from Sigma-Aldrich
CD23, CD23A, CLEC4J, FCE2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008928, RRID:AB_1846285
Product name
Anti-FCER2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008928
Antibody type
Polyclonal
Antigen
Low affinity immunoglobulin epsilon Fc receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGS
WIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRS
QGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCT
PPASEGSAESMGPDSRPDP
Storage
-20C
Provider Type Product Number
- No reagents -