Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501960 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-APOBEC1 antibody: synthetic peptide directed towards the N terminal of human APOBEC1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Rabbit
- Host
- Rabbit
- Antigen sequence
TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEA
CLLYE IKWGMSRKIW- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Investigation of the Lith6 candidate genes APOBEC1 and PPARG in human gallstone disease.
Schafmayer C, Völzke H, Buch S, Egberts J, Spille A, von Eberstein H, Franke A, Seeger M, Hinz S, Elsharawy A, Rosskopf D, Brosch M, Krawczak M, Foelsch UR, Schafmayer A, Lammert F, Schreiber S, Faendrich F, Hampe J, Tepel J
Liver international : official journal of the International Association for the Study of the Liver 2007 Sep;27(7):910-9
Liver international : official journal of the International Association for the Study of the Liver 2007 Sep;27(7):910-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting