Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2166998 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Anti-Mullerian Hormone (AMH) antibody
- Antibody type
- Monoclonal
- Antigen
- The immunogen for anti-AMH antibody: synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
- Reactivity
- Human
- Host
- Mouse
- Vial size
- 0.1 mL
- Storage
- Store at +4°C or at -20°C if preferred. This product should be stored undiluted. Storage in frost-free freezers is not recommended.
- Handling
- Avoid repeat freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data