Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311415 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Troponin T3, Skeletal, Fast (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the N terminal of human TNNT3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQA
LIDSH FEARKKEEEE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nonmyofilament-associated troponin T3 nuclear and nucleolar localization sequence and leucine zipper domain mediate muscle cell apoptosis.
Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function.
Zhang T, Birbrair A, Delbono O
Cytoskeleton (Hoboken, N.J.) 2013 Mar;70(3):134-47
Cytoskeleton (Hoboken, N.J.) 2013 Mar;70(3):134-47
Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function.
Robinson P, Lipscomb S, Preston LC, Altin E, Watkins H, Ashley CC, Redwood CS
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Mar;21(3):896-905
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Mar;21(3):896-905
No comments: Submit comment
No validations: Submit validation data