Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406165 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Troponin T3, Skeletal, Fast (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the C terminal of human TNNT3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSK
KAGTP AKGKVGGRWK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Troponin T nuclear localization and its role in aging skeletal muscle.
Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function.
Zhang T, Birbrair A, Wang ZM, Taylor J, Messi ML, Delbono O
Age (Dordrecht, Netherlands) 2013 Apr;35(2):353-70
Age (Dordrecht, Netherlands) 2013 Apr;35(2):353-70
Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function.
Robinson P, Lipscomb S, Preston LC, Altin E, Watkins H, Ashley CC, Redwood CS
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Mar;21(3):896-905
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Mar;21(3):896-905
No comments: Submit comment
No validations: Submit validation data