HPA012069

LILRB5 antibody from MilliporeSigma / Merck KGaA
CD85c, LIR-8, LIR8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012069
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA012069, RRID:AB_1852873
Product name
Anti-LILRB5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA012069
Antibody type
Polyclonal
Antigen
Leukocyte immunoglobulin-like receptor subfamily B member 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLD
KEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRY
RCYYETPAGWSEPSDPLELVATG
Storage
-20C
Provider Type Product Number
- No reagents -