HPA011922

SGCG antibody from Sigma-Aldrich
A4, DAGA4, DMDA, DMDA1, LGMD2C, MAM, MGC130048, SCARMD2, SCG3, TYPE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011922
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011922, RRID:AB_1856797
Product name
Anti-SGCG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011922
Antibody type
Polyclonal
Antigen
Gamma-sarcoglycan recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSS
DGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICV
CPDGKLYLSVAGVSTTCQEHNHICL
Storage
-20C
Provider Type Product Number
- No reagents -