HPA011922

SGCG antibody from Atlas Antibodies
A4, DAGA4, DMDA, DMDA1, LGMD2C, MAM, MGC130048, SCARMD2, SCG3, TYPE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011922
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011922, RRID:AB_1856797
Product name
Anti-SGCG
Provider product page
Atlas Antibodies - HPA011922
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSS
DGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICV
CPDGKLYLSVAGVSTTCQEHNHICL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -