Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006493-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006493-A01, RRID:AB_462852
- Product name
- SIM2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SIM2.
- Antigen sequence
ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPM
LPAKFGQPQGSPCEVARFFLSTLPASGECQWHYAN
PLVPSSSSPAKNPPEPPANTARHSLVPSYE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Celastrol regulates multiple nuclear transcription factors belonging to HSP90's clients in a dose- and cell type-dependent way.
Zhang D, Xu L, Cao F, Wei T, Yang C, Uzan G, Peng B
Cell stress & chaperones 2010 Nov;15(6):939-46
Cell stress & chaperones 2010 Nov;15(6):939-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SIM2 polyclonal antibody (A01), Lot # O51024JC01 Western Blot analysis of SIM2 expression in HepG2 ( Cat # L019V1 ).