103-PA60AG

ENG antibody from ReliaTech GmbH
CD105, END, HHT1, ORW, ORW1

Antibody data

Product number
103-PA60AG
Provider
ReliaTech GmbH
Product name
CD105/Endoglin
Provider product page
ReliaTech GmbH - 103-PA60AG
Antibody type
Polyclonal
Antigen
Recombinant mouse sCD105/Endoglin
Description
antibody affinity purified from serum
Reactivity
Mouse
Host
Rabbit
Antigen sequence
ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANA
VREVHVLFLDFPGMLSHLELTLQASKQNGTETQEV
FLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQ
PRVNITVLPSLTSRKQILDWAATKGAITSIAALDD
PQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPR
AQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTV
TVMMELSCTSGDAILILHGPPYVSWFIDINHSMQI
LTTGEYSVKIFPGSKDKGVELPDTPQGLIAEARKL
NASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPV
VTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKH
VQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSS
CGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMD
SLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSP
LTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSC
VTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNL
ALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
Antibody clone number
Rabbit IG
Vial size
50 µl
Storage
Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
Handling
Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Provider Type Product Number
- No reagents -