ABIN630265

antibody from antibodies-online

Targeting: ENG CD105, END, HHT1, ORW, ORW1

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630265 - Provider product page
Provider: antibodies-online
Product name: anti-CD105 (Endoglin / TGF-Beta1/3 Receptor) antibody
Antibody type: Polyclonal
Antigen: Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids GLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGG
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

ENG protein structure - ABIN630265 shown in red.