Antibody data

Product number
H00090850-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00090850-M11, RRID:AB_1112631
Product name
ZNF598 monoclonal antibody (M11), clone 1E2
Provider product page
Abnova Corporation - H00090850-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF598.
Antigen sequence
SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQ
RYCAVCREELRQVVFGKKLPAFATIPIHQLQHEKK
YDIYFADGKVYALYRQLLQHECPRCPELP
Isotype
IgG
Antibody clone number
1E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -