HPA041229

TRAF7 antibody from Atlas Antibodies
DKFZp586I021, MGC7807, RFWD1, RNF119
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041229
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041229, RRID:AB_10794194
Product name
Anti-TRAF7
Provider product page
Atlas Antibodies - HPA041229
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGS
ADCTIIVWDIQNLQKVNTIRAHDNPVCTLVSSHNV
LFSGSLKAIKVWDIVGTELKLKKELTGLNHWVR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -